Web stats for Hammaslaakaripaivatnayttely - hammaslaakaripaivatnayttely.fi
Suomen suurin hammaslääketieteen koulutustapahtuma ja näytttely. Kouluttaudu, kehity ja verkostoidu suun hoidon suurimmassa ammattitapahtumassa.
Traffic Report of Hammaslaakaripaivatnayttely
| Daily Unique Visitors: | Not Applicable |
| Daily Pageviews: | Not Applicable |
Estimated Valuation
| Income Per Day: | $ 0.15 |
| Estimated Worth: | $ 8.95 |
Search Engine Indexes
| Google Indexed Pages: | Not Applicable |
| Yahoo Indexed Pages: | Not Applicable |
| Bing Indexed Pages: | Not Applicable |
Search Engine Backlinks
| Google Backlinks: | Not Applicable |
| Bing Backlinks: | Not Applicable |
| Alexa BackLinks: | Not Applicable |
Safety Information
| Google Safe Browsing: | No Risk Issues |
| Siteadvisor Rating: | Not Applicable |
| WOT Trustworthiness: | Not Applicable |
| WOT Privacy: | Not Applicable |
| WOT Child Safety: | Not Applicable |
Website Ranks & Scores
| Google Pagerank: | Not Applicable |
| Alexa Rank: | Not Applicable |
| Domain Authority: | Not Applicable |
PageSpeed Score
Siteadvisor Rating
Not Applicable
Where is hammaslaakaripaivatnayttely.fi server located?
Hosted IP Address:
77.86.189.241
Hosted Country:
FI
Location Latitude:
60.1695Location Longitude:
24.9354Social Engagement
| Facebook Shares: | Not Applicable |
| Facebook Likes: | Not Applicable |
| Facebook Comments: | Not Applicable |
| Twitter Count (Tweets): | Not Applicable |
| Linkedin Shares: | Not Applicable |
| Delicious Shares: | Not Applicable |
Page Resources Breakdown
Homepage Links Analysis
Website Inpage Analysis
| H1 Headings: | 3 | H2 Headings: | 1 |
| H3 Headings: | Not Applicable | H4 Headings: | Not Applicable |
| H5 Headings: | Not Applicable | H6 Headings: | Not Applicable |
| Total IFRAMEs: | 1 | Total Images: | 4 |
| Google Adsense: | Not Applicable | Google Analytics: | Not Applicable |
Websites Hosted on Same IP (i.e. 77.86.189.241)
ViherTek - 12.-14.10.2016 Messukeskus, Helsinki
ViherTek on ympäristösuunnittelun, -rakentamisen ja -hoidon vuoden tärkein ammattitapahtuma.
Not Applicable 
$ 8.95
Kiinteistö 26. - 27.9.2017 Messukeskus Helsinki
Kiinteistönhoidon, isännöinnin ja kiinteistöjen peruskorjauksen vuoden tärkein tapahtuma 26.-27.9.2017 Messukeskuksessa Helsingissä.
Not Applicable $ 8.95
FinnSec 26.-27.9.2017 Messukeskus Helsinki
Pohjoismaiden suurin turvallisuusalan tapahtuma 26.-27.9.2017. Tapahtumassa kohtaavat alan päättäjät ja tekijät sekä yritysten turvallisuudesta vastaavat
Not Applicable $ 8.95
Studia-messut | Messukeskus | 29. - 30.11.2016
Suomen suurin opiskelu- ja uratapahtuma Studia. Avoinna ti 29.11. klo 9–17, ke 30.11. klo 9–16. Tervetuloa!
Not Applicable $ 8.95
HTTP Header Analysis
Status-Code: 200
Status: 200 OK
Date: Sun, 01 Jan 2017 07:54:05 GMT
Content-Type: text/html; charset=UTF-8
Expires: Thu, 19 Nov 1981 08:52:00 GMT
Cache-Control: no-store, no-cache, must-revalidate, post-check=0, pre-check=0
Pragma: no-cache
Link:
X-UA-Compatible: IE=Edge
X-Varnish: 1791081 7118082
Age: 7110
Via: 1.1 varnish-v4
X-Cache: cached
Content-Length: 35135
Accept-Ranges: bytes
Domain Information for hammaslaakaripaivatnayttely.fi
| Domain Registrar: |
Finnish Communications Regulatory Authority
|
|---|
Domain Nameserver Information
| Host | IP Address | Country | |
|---|---|---|---|
| ns1.mynebula.fi |
|
217.30.180.225 |
Finland
|
| ns2.mynebula.fi |
|
217.30.182.225 |
Finland
|
DNS Record Analysis
| Host | Type | TTL | Extra |
|---|---|---|---|
| hammaslaakaripaivatnayttely.fi | A | 3600 |
IP:77.86.189.241 |
| hammaslaakaripaivatnayttely.fi | NS | 3600 |
Target:ns1.mynebula.fi |
| hammaslaakaripaivatnayttely.fi | NS | 3600 |
Target:ns2.mynebula.fi |
| hammaslaakaripaivatnayttely.fi | SOA | 3600 |
MNAME:ns1.mynebula.fi RNAME:hostmaster.mynebula.fi Serial:979483 Refresh:1800 Retry:600 Expire:86400 |
Similarly Ranked Websites to Hammaslaakaripaivatnayttely
Search the world's information, including webpages, images, videos and more. Google has many special features to help you find exactly what you're looking for.
1 $ 8,833,062,960.00
Google Calendar - Sign in to Access & Edit Your Schedule
Access Google Calendar with a Google account (for personal use) or Google Workspace account (for business use).
1 $ 8,833,062,960.00
Gmail
Gmail is email that’s intuitive, efficient, and useful. 15 GB of storage, less spam, and mobile access.
1 $ 8,833,062,960.00
Android Apps on Google Play
Enjoy millions of the latest Android apps, games, music, movies, TV, books, magazines & more. Anytime, anywhere, across your devices.
1 $ 8,833,062,960.00
Google Chrome - Download the Fast, Secure Browser from Google
Get more done with the new Google Chrome. A more simple, secure, and faster web browser than ever, with Google’s smarts built-in. Download now.
1 $ 8,833,062,960.00
Full WHOIS Lookup for hammaslaakaripaivatnayttely.fi
status.............: Registered
created............: 15.11.2010
expires............: 15.11.2018
available..........: 15.12.2018
modified...........: 24.12.2016
RegistryLock.......: no
Nameservers
nserver............: ns2.mynebula.fi [OK]
nserver............: ns1.mynebula.fi [OK]
dnssec.............: unsigned delegation
Holder
name...............: Suomen Messut Osuuskunta
register number....: 0116322-3
address............: Tietohallinto / Sami Nieminen
address............: Messuaukio 1, PL 21
address............: 00521
address............: Helsinki
country............: Finland
phone..............: +358404503250
holder email.......:
Registrar
registrar..........: Nebula Oy
www................: www.nebula.fi
>>> Last update of WHOIS database: 1.1.2017 11:46:07 (EET)